Loading...
Statistics
Advertisement

_/ Didier Gourmelon - architecte + paysagiste \_
www.gourmelon.org/
Didier Gourmelon - architecte dplg + paysagiste cesp - installé à Argenteuil

Gourmelon.org

Advertisement
Conversion Technology Metas Server
Gourmelon.org is hosted in France . Gourmelon.org doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 1. First javascripts: Swfobject.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache/2.2.22 (Debian).

Technologies in use by Gourmelon.org

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • Swf Object

Advertisement

Javascripts

Number of occurences: 1
  • swfobject.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.2.22 (Debian)

Powered by

  • PHP/5.4.45-0+deb7u1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Gourmelon.org

Missing HTTPS protocol.

    Meta - Gourmelon.org

    Number of occurences: 9
    • Name:
      Content: text/html; charset=utf-8
    • Name: description
      Content: Didier Gourmelon - architecte dplg + paysagiste cesp - installé à Argenteuil
    • Name: keywords
      Content: Didier Gourmelon, architecte dplg, paysagiste cesp, Argenteuil, villa, maison, appartement, immeuble, aménagement, architecture, circuits de visite, muséographie, tourisme industriel, urbanisme, paysage, jardins, gestion de copropriétés, maîtrise d'oeuvre publique et privée
    • Name: author
      Content: Claire Durlin
    • Name: identifier-url
      Content: http://www.gourmelon.org/
    • Name: copyright
      Content: Copyright © 2009 par Didier Gourmelon & Claire Durlin
    • Name: reply-to
      Content: didier.gourmelon@free.fr
    • Name: revisit-after
      Content: 15 days
    • Name: robots
      Content: Index, Follow

    Server / Hosting

    • IP: 37.59.60.121
    • Latitude: 48.86
    • Longitude: 2.34
    • Country: France

    Rname

    • dns13.ovh.net
    • ns13.ovh.net
    • gourmelon.org

    Target

    • tech.ovh.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 13 Apr 2016 10:38:21 GMT Server: Apache/2.2.22 (Debian) X-Powered-By: PHP/5.4.45-0+deb7u1 Vary: Accept-Encoding Content-Type: text/html

    DNS

    host: gourmelon.org
    1. class: IN
    2. ttl: 86399
    3. type: A
    4. ip: 37.59.60.121
    host: gourmelon.org
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns13.ovh.net
    host: gourmelon.org
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns13.ovh.net
    host: gourmelon.org
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: dns13.ovh.net
    5. rname: tech.ovh.net
    6. serial: 2014092904
    7. refresh: 86400
    8. retry: 3600
    9. expire: 3600000
    10. minimum-ttl: 86400
    host: gourmelon.org
    1. class: IN
    2. ttl: 86400
    3. type: MX
    4. pri: 1
    5. target: gourmelon.org

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ourmelon.org, www.gsourmelon.org, www.sourmelon.org, www.gxourmelon.org, www.xourmelon.org, www.gyourmelon.org, www.yourmelon.org, www.ghourmelon.org, www.hourmelon.org, www.gnourmelon.org, www.nourmelon.org, www.gcourmelon.org, www.courmelon.org, www.gdourmelon.org, www.dourmelon.org, www.geourmelon.org, www.eourmelon.org, www.grourmelon.org, www.rourmelon.org, www.gtourmelon.org, www.tourmelon.org, www.gbourmelon.org, www.bourmelon.org, www.gvourmelon.org, www.vourmelon.org, www.gurmelon.org, www.goburmelon.org, www.gburmelon.org, www.gohurmelon.org, www.ghurmelon.org, www.gogurmelon.org, www.ggurmelon.org, www.gojurmelon.org, www.gjurmelon.org, www.gomurmelon.org, www.gmurmelon.org, www.go urmelon.org, www.g urmelon.org, www.govurmelon.org, www.gvurmelon.org, www.gormelon.org, www.gouwrmelon.org, www.gowrmelon.org, www.gouermelon.org, www.goermelon.org, www.gousrmelon.org, www.gosrmelon.org, www.gouarmelon.org, www.goarmelon.org, www.goumelon.org, www.gourimelon.org, www.gouimelon.org, www.gouromelon.org, www.gouomelon.org, www.gourlmelon.org, www.goulmelon.org, www.gourlmelon.org, www.goulmelon.org, www.gour.melon.org, www.gou.melon.org, www.gourelon.org, www.gourmpelon.org, www.gourpelon.org, www.gourmoelon.org, www.gouroelon.org, www.gourmielon.org, www.gourielon.org, www.gourmkelon.org, www.gourkelon.org, www.gourm.elon.org, www.gour.elon.org, www.gourmuelon.org, www.gouruelon.org, www.gourmjelon.org, www.gourjelon.org, www.gourmnelon.org, www.gournelon.org, www.gourm-elon.org, www.gour-elon.org, www.gourmlon.org, www.gourmexlon.org, www.gourmxlon.org, www.gourmeslon.org, www.gourmslon.org, www.gourmewlon.org, www.gourmwlon.org, www.gourmerlon.org, www.gourmrlon.org, www.gourmeflon.org, www.gourmflon.org, www.gourmevlon.org, www.gourmvlon.org, www.gourmeclon.org, www.gourmclon.org, www.gourmeqlon.org, www.gourmqlon.org, www.gourmealon.org, www.gourmalon.org, www.gourmeylon.org, www.gourmylon.org, www.gourmeon.org, www.gourmeluon.org, www.gourmeuon.org, www.gourmel8on.org, www.gourme8on.org, www.gourmel9on.org, www.gourme9on.org, www.gourmeljon.org, www.gourmejon.org, www.gourmel0on.org, www.gourme0on.org, www.gourmelmon.org, www.gourmemon.org, www.gourmelpon.org, www.gourmepon.org, www.gourmeloon.org, www.gourmeoon.org, www.gourmeln.org, www.gourmelobn.org, www.gourmelbn.org, www.gourmelohn.org, www.gourmelhn.org, www.gourmelogn.org, www.gourmelgn.org, www.gourmelojn.org, www.gourmeljn.org, www.gourmelomn.org, www.gourmelmn.org, www.gourmelo n.org, www.gourmel n.org, www.gourmelovn.org, www.gourmelvn.org, www.gourmelo.org, www.gourmelonn.org, www.gourmelon.org, www.gourmelonh.org, www.gourmeloh.org, www.gourmelonj.org, www.gourmeloj.org, www.gourmelonk.org, www.gourmelok.org, www.gourmelonl.org, www.gourmelol.org, www.gourmelon .org, www.gourmelo .org,

    Other websites we recently analyzed

    1. Ostrowscyband
      Zywiec (Poland) - 91.234.217.195
      Server software: nginx
      Technology: CSS, Html, Javascript, jQuery
      Number of Javascript: 9
      Number of meta tags: 1
    2. GPI Corporate - Promotional Products - Clothing & Merchandise - Corporate Gifts
      Australia - 203.12.234.236
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Javascript, Swf Object, Google Analytics
      Number of Javascript: 3
      Number of meta tags: 1
    3. 登录
      Beijing (China) - 182.254.245.96
      Server software: nginx/1.1.18
      Technology: CSS, Html, Html5, Iframe, Javascript, jQuery Cookie, jQuery UI
      Number of Javascript: 10
      Number of meta tags: 1
    4. www.gasnonprofit.org
      Houston (United States) - 108.167.135.120
      Server software: Microsoft-IIS/7.5
      Technology: CSS
    5. Jak można schudnąć z zielonym jęczmieniem? Tabletki jęczmień bio!
      Poland - 188.116.9.209
      Server software: Apache
      Technology: BootstrapCDN, Maxcdn, AJAX Libraries API, CSS, Html, Html5, Javascript, Yandex.Metrika
      Number of Javascript: 2
      Number of meta tags: 6
    6. Busch & Endres GmbH - Ihr Partner für ein intelligentes Zuhause!
      Busch & Endres GmbH – Experte für Smart Home, Hausautomatisierung, individuelle Multiroom Installation, Lichtkonzepte und elektrische Haussteuerung.
      Germany - 87.106.122.198
      G Analytics ID: UA-51678759-1
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Google Analytics, Facebook Box
      Number of Javascript: 1
      Number of meta tags: 4
    7. YSG EMLAK | Edremit | Burhaniye | Ayvalık | Havran | Gömeç
      Turkey - 213.142.138.4
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Flexslider, Html, Html5, Javascript
      Number of Javascript: 12
      Number of meta tags: 4
    8. Bienvenue
      Voici la page daccueil
      Ashburn (United States) - 23.21.62.221
      Server software: Redirector/1.0
      Technology: DoubleClick.Net, CSS, Html, Iframe, Javascript
      Number of Javascript: 21
      Number of meta tags: 4
    9. arizonarent.com
      Kirkland (United States) - 98.124.245.24
      Server software: Apache
      Technology: Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 1
    10. financialserviceshypermarket.com
      United Kingdom - 62.233.121.61
      Server software: Apache/2.2.15 (CentOS)
      Technology: CSS, Html, Html5, Javascript
      Number of meta tags: 5

    Check Other Websites